PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_11777_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family EIL
Protein Properties Length: 376aa    MW: 44171.9 Da    PI: 6.2938
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_11777_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3330.54.2e-101483011263
                     XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWW 95 
                     eelkkrmwkd+m++ +lke+++   e+       ++ ++++e++rrkkmsraQ +iLkY +k+me+cnaqGfvY i+pekgkpv g+sdsL +WW
  Neem_11777_f_2  48 EELKKRMWKDRMRMHKLKEKREI--EE-------SELSTREEASRRKKMSRAQTSILKYVVKIMEACNAQGFVYAIVPEKGKPVIGSSDSLHKWW 133
                     8**************88887764..23.......3345689****************************************************** PP

                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT..--T CS
            EIN3  96 kekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelg..lsk 188
                     ke+++fd  +p+ai+ky+++  +    + +q+++ss  h l++l D tlgSL salmqh  ppqrrfp e+g +pPWWPtGke wwge+g  + +
  Neem_11777_f_2 134 KEQIRFDHYAPVAIAKYKPAFELHR--ELNQSSPSSFVHLLHQLEDNTLGSLVSALMQHWVPPQRRFPIERGSAPPWWPTGKERWWGEQGihMIE 226
                     *****************87666654..3335689********************************************************76677 PP

                     T--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX CS
            EIN3 189 dqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah 263
                     ++g+ppyk +hdlkkawkvsvL+  ikh+sp++++ir l+ +sk lq km+ake++++++v+nqee+++      
  Neem_11777_f_2 227 EHGPPPYKRSHDLKKAWKVSVLAGIIKHTSPNLNRIRSLVSESKFLQYKMMAKEKDTWCKVVNQEEALLPAPEEA 301
                     888***************************************************************987544433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048733.8E-10048292No hitNo description
Gene3DG3DSA:1.10.3180.108.9E-57164295IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167689.94E-50169294IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MVKIYEERDA VNRGEEEEDE DEEISYEELK KRMWKDQEED EDEEISYEEL KKRMWKDRMR  60
MHKLKEKREI EESELSTREE ASRRKKMSRA QTSILKYVVK IMEACNAQGF VYAIVPEKGK  120
PVIGSSDSLH KWWKEQIRFD HYAPVAIAKY KPAFELHREL NQSSPSSFVH LLHQLEDNTL  180
GSLVSALMQH WVPPQRRFPI ERGSAPPWWP TGKERWWGEQ GIHMIEEHGP PPYKRSHDLK  240
KAWKVSVLAG IIKHTSPNLN RIRSLVSESK FLQYKMMAKE KDTWCKVVNQ EEALLPAPEE  300
AGKQEETPHF NKDKHVINME LAKADEKITY NIDLIEDSGD GSGSGSSVED YANASYWVNG  360
NNVDYIYSRH EWRIIK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A1e-481672941126Protein ETHYLENE INSENSITIVE 3
4zds_B1e-481672941126Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012064823.11e-121PREDICTED: putative ETHYLENE INSENSITIVE 3-like 4 protein
SwissprotQ9FJQ51e-110EIL5_ARATH; ETHYLENE INSENSITIVE 3-like 5 protein
TrEMBLV7CRS51e-120V7CRS5_PHAVU; Uncharacterized protein
STRINGGLYMA05G31410.11e-116(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58792747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65100.11e-98EIL family protein